weebly reliable statistics

De quoi sommes-nous faits?


Une vidéo (anglais) pour comprendre le rôle de l'insuline


Découvrez l'insuline et quelques outils bioinformatiques

 
La protéine insuline est une hormone qui agit comme une clé qui ouvre une porte permettant l’entrée du sucre (glucose) dans les cellules de notre organisme.
Si notre pancréas ne produit pas une quantité suffisante d’insuline ou que celle-ci n’arrive pas à faire son travail correctement, le diabète apparaît.

Activité 1: Comparaison de séquences ADN

Voici un morceau de la séquence ADN du gène qui code pour l'insuline, chez 3 patients différents:
>Patient1
cagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctacc
tagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggacc

>Patient2
cagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctacc
tagtgtgcggggaacgaggcttcttctacacacccaagacctgtcgggaggcagaggacc 

>Patient3
cagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctacc
tagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggacc

Question:


Approche manuelle (pour les plus motivés, courage...):
* Comparer les 3 séquences et localiser la variation c -> t

Approche bioinformatique:
Construire un alignement des 3 séquences à l'aide d'un outil bioinformatique
* Copier/coller les 3 séquences (inclue la ligne '>Patient') dans l'outil d'alignement
* Cliquer sur l'icône 'align'
* Page des résultats, colonne de gauche: Sélectionner Highlight: 'Similarity'

Pour les experts: voici la liste des variants (en rouge) connus du gène de l'insuline (Publication).

Du génome au variant responsable d'une maladie, des chiffres qui en disent long (Publication)

Activité 2: BLAT - ADN: le gène de l'insuline dans le génome humain

Voici un morceau de la séquence ADN du gène qui code pour l'insuline...
tagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggacc 

Question:


Approche bioinformatique:
Faire un 'BLAT' contre le génome humain
* Copier/coller la séquence
* Cliquer sur 'submit'
* Cliquer sur 'browser'


Info technique: BLAT est un outil bioinformatique qui permet de comparer une séquence ADN avec la séquence entière d'un génome (soit un texte de 3 milliards de lettres pour le génome humain)et de retrouver, si elle existe, celle qui lui ressemble le plus, en quelques secondes. On peut ainsi rapidement retrouver sur quel chromososome se trouve une séquence ADN donnée.

Activité 3: Traduction ADN -> protéine

Voici un morceau de la séquence ADN du gène de l'insuline 'normale'.
aag acc cgc cgg gag 
Voici un morceau de la séquence ADN du gène de l'insuline avec la variation c -> t, associée avec un diabète.
aag acc tgc cgg gag 

Question:


Vous pourriez traduire manuellement les séquences en acide nucléique en séquence en acide aminé (code '1 lettre') en utilisant le code génétique ci-dessous:
 

Vous pouvez utiliser l'outil bioinformatique 'Translate'

Réponse: La mutation c -> t dans le gène de l'insuline conduit au remplacement de l'acide aminé R (arginine; codon cgc) par l'acide aminé C (cystéine; codon cgt) en position 55:
ce changement empêche la protéine insuline d'être 'coupée', un processus qui est essentiel pour que l'insuline puisse être fonctionnelle (Molven et al., 2008).

 

Activité 4: Visualiser la structure 3D de l'insuline


 
Les chercheurs sont capables (depuis 1958) de cristalliser des protéines et de les 'prendre en photo' à l'aide des rayons X.
Les résultats de ces expériences sont ensuite analysés grâce à des programmes bioinformatiques: on peut ainsi visualiser la structure des protéines... et de l'insuline

Activité 4: BLAST - Protéine


Voici la séquence complète en acide aminé de l'insuline 'normale':
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Question:


Approche bioinformatique:
Faire un 'BLAST' contre une banque de données de protéines, UniProtKB
* Copier coller la sequence dans la boîte 'Protein sequence'
* Sélectionner 'Target database = UniProtKB/Swiss-Prot'
* Cliquer sur le bouton 'BLAST' * Rechercher les images correspondant au nom de l'espèce sur Google (exemple 'Amia calva')

Info technique: BLAST (Basic Local Alignment Search Tool) est un outil bioinformatique qui permet de comparer la séquence d'une protéine avec des millions d'autres séquences contenues dans les banques de données et de retrouver, si elles existent, celles qui lui ressemblent le plus, en quelques secondes. On peut ainsi rapidement savoir si une protéine existe dans une espèce donnée, ou identifier une séquence inconnue.


Activité 5: Structure 3D


 
Les chercheurs sont capables (depuis 1958) de cristalliser des protéines et de les 'prendre en photo' à l'aide des rayons X.
Les résultats de ces expériences sont ensuite analysés grâce à des programmes bioinformatiques: on peut ainsi visualiser la structure des protéines.

Petit rappel: de la séquence d'une protéine à sa structure 3D (pdf)

Et aussi...une animation en musique pour bien comprendre la structure des protéines (texte en anglais)

Visualiser la structure 3D de l'insuline (cliquer sur 'View in Jmol')
* Modifier les 'Display Options' - pour voir les atomes, choisir Style: Ball and Stick

Pour le fun, voici les données expérimentales brutes - les coordonnées spatiales (X, Y, Z) de chaque atome de chaque acide aminé de l'insuline ! (chercher 'ATOM' dans la page)


Activité 6: L'insuline et www.chromosomewalk.ch

 
www.chromosomewalk.ch est une exposition virtuelle pour (re)découvrir le monde des gènes, des protéines et de la bioinformatique....

Depuis la liste des chromosomes humains: rechercher 'insuline'

Vérifiez que vous êtes de vrais experts : quiz expert !

Activité 7: Une enquête bioinformatique...


Un verre contenant un liquide blanchâtre a été retrouvé sur les lieux d'un crime. Des experts ont analysé ce liquide et séquencé les protéines qui s'y trouvaient. A vous d'identifier ces protéines et de découvrir peut-être la cause du décès !

Voici les séquences (fragments) des protéines qui ont été retrouvées dans le liquide.
> seq 1
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL

> seq 2
MKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVR
 
> seq 3
MKFFIFTCLLAVALAKHKMEHVSSSEEPINIFQEIYKQEKNMAIHPRKEKLCTTSCEEVV

> seq 4
MIEVLLVTICLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYELK

> seq 5
MISSHQKTLTDKELALISGGKTHYPTNAWKSLWKGFWESLRYTDGF


Approche bioinformatique:
Faire un 'BLAST' contre UniProtKB, la banque de données de protéines
* Copier coller une séquence dans la boîte 'Sequence'
* Sélectionner 'Database' = UniProtKB/Swiss-Prot'
* Cliquer sur le bouton 'BLAST'

Solution

Cet exemple a été adapté du site Bioinfo@school


Pour nous contacter...