You are here: Home  >  Education  >  Ateliers de bioinformatique


Update: octobre 2020

Atelier découverte de la bioinformatique

Un peu de biologie et de bioinformatique:

(#1) Voici une séquence d'ADN inconnue
...

A toi de découvrir quelle information elle contient, pour quelle protéine elle code, sur quel chromosome elle se trouve et bien plus encore....

atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccagccgcagcctttgtgaaccaacacctgtgcggctcacacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggtggggcaggtggagctgggcgggggccctggtgcaggcagcctgcagcccttg
gccctggaggggtccctgcagaagcgtggcattgtggaacaatgctgtaccagcatctgc
tccctctaccagctggagaactactgcaactagacgcagcccgcaggcagccccccaccc
gccgcctcctgcaccgagagagatggaataaagcccttgaaccagc

Traduit la séquence ADN en séquence d'acides aminés (protéine)

(1) Traduit la séquence ADN  manuellement en utilisant le code génétique...
 

ATG -> Met (M)
GCC -> Ala (A)

Quels sont les 10 premiers acides aminés de la séquence de ta protéine ?


Code 3 lettres: ................................................


Code 1 lettre: .................................................


(2) Traduit la séquence ADN  avec l'aide de l'ordinateur en utilisant: http://web.expasy.org/translate/
    (Choisit l'option 'Verbose' (pour avoir le code 3 lettres), puis l'option 'Compact' (pour avoir le code 1 lettre)

Recopie les 10 premiers acides aminés et compare avec tes résultats précédents: ..................................
(Truc: ta  séquence (en rose) se trouve dans le 'Frame 1')

Pour les experts: il existe plusieurs codes génétiques (http://web.expasy.org/translate/)
Combien de codes génétiques différents ? .................................................



Un jeu (SCRATCH) pour comprendre les codons (de l'ADN aux acides aminés) : quel score ?


***************************************************************************************************

(#2) Identifie la protéine inconnue en comparant la séquence que tu as obtenue avec les séquences de protéines qui se trouvent dans une banque de données ... 

(1) Essaye de le faire manuellement en comparant la séquence en acide aminé que tu as obtenue avec les séquences
    présentes sur les différentes fiches Banque de données de protéines (pdf)
    Truc: utilise Crtl F pour trouver la séquence d'acides aminés dans le document....
 
    Qu'en penses-tu ?.............................................

(2) Essaye de le faire avec l'aide de l'ordinateur et utilise un outil bioinformatique appelé BLAST 
   
-> Fais un BLAST @ http://www.uniprot.org/blast contre la banque de données UniProtKB/Swiss-Prot
(copier coller la séquence en acide aminé dans la boîte 'Protein sequence', sélectionner 'Target database' = UniProtKB/Swiss-Prot, puis cliquer sur le bouton 'Run BLAST')


Cette protéine s'appelle :...........................

De quel organisme ?: .......................

Pour les experts: de combien d'acides aminés est-elle composée ?.............................

Chercher des informations sur cette protéine dans wikipedia:

Quelle est sa fonction ?............................

La fonction de la protéine dans UniProtKB/Swiss-Prot (en anglais): http://www.uniprot.org/uniprot/P01308#function

La localisation de la protéine dans la cellule dans UniProtKB/Swiss-Prot (en anglais): https://www.uniprot.org/uniprot/P01308#subcellular_location

***************************************************************************************************
(#3) Facultatif, pour les experts....

Visualise la structure primaire de l'insuline  (Draw peptide)
http://pepdraw.com/

Visualise la structure 3D de l'insuline:
https://www.rcsb.org/3d-view/2C8Q/

Découvre la structure 3D de différentes protéines (il faut que Java soit installé sur l'ordinateur):
http://education.expasy.org/structure_browser/structure_browser.html

***************************************************************************************************

(#4) de l'ADN, des  chromosomes, différentes espèces....

Les chromosomes humains (caryotype): combien de chromosomes ? ......

Sur quel chromosome humain se trouve l'ADN codant pour la protéine insuline ? ........

Voici la démarche pour trouver la réponse:

A l'aide de Blat @ UCSC
Copier/coller la séquence ADN du gène de l'insuline:

atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac

Cliquer sur submit


*****

Toujours avec l'aide de Blat @ UCSC :
Vérifie que la séquence ADN imprimée dans le livre 'Chromosome 21'  est bien une séquence qui se trouve sur le chromosome 21 humain....

Truc: taper au moins 30 lettres....

Photo d'une page du livre (1500 pages, 48'000'000 de lettres ADN):


*****
Toujours avec l'aide de Blat @ UCSC:
La police scientifique utilise cette séquence ADN pour identifier le sexe d'un suspect.
Vérifie que cette séquence ADN n'est retrouvée que sur le chromosome Y:
    atgcaatcatatgcttctgctatgttaagcgtattc
Retrouves-tu cette séquence ADN sur un chromosome du chimpanzé (chimp) ? Si oui, lequel ? .................
- les chromosomes du chimpanzé (caryotype): combien de chromosomes ? ......

Retrouves-tu cette séquence ADN sur un chromosome du chat (cat) ? Si oui, lequel ?.....................
- les chromosomes du chat (caryotype): combien de chromosomes ? ......

Retrouves-tu cette séquence ADN sur un chromosome du poulet (chicken) ? Si oui, lequel ?.....................
- les chromosomes du poulet (caryotype): combien de chromosomes ? ......

*****

Tape au hasard une séquences ADN longue de 30 lettres (avec les 4 lettres  A, T, G, C) : la retrouves-tu chez une espèce ?

*********************************************************************************

(#5) Une introduction à la classification des espèces (phylogénie)...



Clique sur les liens suivants et répond aux questions:
Quel arbre des espèces est le plus juste ?

Quelle séquence appartient à quelle espèce ?

*****

Peux-tu deviner quelle séquence  (A ou B) appartient au poulet et laquelle appartient au cochon ?

    HUMAN  MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
A   MALWTRLLPLLALLALWAPAPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREAEN
B  MALWIRSLPLLALLVFSGPGTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDVEQ
       **** * *******.: .* .: * .************************:**:**:.*:
*****

Trouve qui est le cousin de qui
en utilisant le programme Philophylo:
http://education.expasy.org/cgi-bin/philophylo/philophylo.cgi

Qui est le 'cousin' du tyranosaure ?
- Tu peux découvrir qui a un ancêtre commun avec le tyranosaure en construisant un arbre phylogénétique avec les séquences de collagène

Qui est le 'cousin' du dodo et du mammouth ?
- Tu peux découvrir qui a un ancêtre commun avec le dodo ou le mammouth en construisant un arbre phylogénétique avec les séquences du cytochrome B

Qui est le 'cousin' du concombre ?
- Tu peux découvrir qui a un ancêtre commun avec le concombre en construisant un arbre phylogénétique avec les séquences Récepteur à l'éthylène

*****

Pour les experts: pour une ballade plus complète dans le monde de la phylogénie:
http://education.expasy.org/bioinformatique/Atelier3.html

**********************************************************************************

(#6) Tous uniques....les variations génétiques (SNPedia):

Un médecin a reçu des morceaux d’ADN provenant de 2 sportifs différents.
Il a mélangé les tubes et a donc besoin de ton aide pour savoir:
http://education.expasy.org/bioinformatique/pdfs/BLAST_protein.pdf

************************************************************************************

(#7) Métagénomique urbaine (Mystères de l'UNIL 2016)

Des chercheurs ont filtré l'air de 3 villes (campagne, montagne et bord de mer).
Ils ont récupéré l'ADN présent dans les filtres et ont tout séquencé.
    aaagcgattggccatggcaaaattattgataacgcggaacag
gagaatttgccaccaaatccctacaaagaaaacttgatga
gatattcataccaccgcggtggcgggcgtgggcgtgcgcaa
gcattcaaggccgtgaagacgagctgctcaatttc
gcgattacccgctggctgtttagcaccaaccataaagatat
gctgcctctgatgtcgcaagtcggcgacaagtttataaat
A toi de déterminer à quelle espèce appartient les différentes séquences d'ADN et de deviner de quelle ville il s'agit (campagne, montagne ou bord de mer)....

Manuellement:
Banque de données Métagénomique Urbaine
Truc: les séquences ADN sont classées dans l'ordre alphabétique...
Truc: utilise Crtl F pour trouver les lettres dans le documents....

Avec des outils bioinformatiques / Blast UniProtKB/Swiss-Prot:
http://www.uniprot.org/blast/

****

(#8) Le gâteau d'anniversaire mystérieux
(Nuit des Musées 2017)

Vanille, cacao, noix de coco: identifie les différentes espèces qui se cachent dans un gâteau d’anniversaire grâce à l’information contenue au cœur de leur ADN !
    attgtcagagcccgcagtgaaaattcgtct
ccgagcgtgattccggcggcgcgcctgtttaaaagctatgt
ctttcgcgcgctgagcgtgtttagcctgtttctgagcta
gcggtgaccagcagcgtggcggataccaccaccg
ggcgtggtggcgctgccgtatagcagcggcaccaccggcctgc
Manuellement:
Banque de données Métagénomique Gâteau
Truc: les séquences ADN sont classées dans l'ordre alphabétique...
Truc: utilise Crtl F pour trouver les lettres dans le documents....

Avec des outils bioinformatiques / Blast UniProtKB/Swiss-Prot:
http://www.uniprot.org/blast/

(#9) La pizza métagénomique
Combien d'espèces différentes dans une pizza ?
Rendez-vous sur l'atelier Pizza métagénomique

****

(#10) Enquête policière


Un verre contenant un liquide blanchâtre a été retrouvé sur les lieux d'un crime. Des experts ont analysé ce liquide et séquencé les protéines qui s'y trouvaient. A toi d'identifier ces protéines et de découvrir peut-être la cause du décès !

Voici les séquences (fragments) des protéines qui ont été retrouvées dans le liquide.
> seq 1
MKVLILACLVALALARELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDEL

> seq 2
MKFFIFTCLLAVALAKNTMEHVSSSEESIISQETYKQEKNMAINPSKENLCSTFCKEVVR
 
> seq 3
MKFFIFTCLLAVALAKHKMEHVSSSEEPINIFQEIYKQEKNMAIHPRKEKLCTTSCEEVV

> seq 4
MIEVLLVTICLAVFPYQGSSIILESGNVNDYEVVYPRKVTALPKGAVQPKYEDAMQYELK

> seq 5
MISSHQKTLTDKELALISGGKTHYPTNAWKSLWKGFWESLRYTDGF

Utilise l'outil bioinformatique Blast / UniProtKB/Swiss-Prot:
http://www.uniprot.org/blast/


***********************************************************************************

(#11) Es-tu devenu un expert en ADN, protéine et bioinformatique ?
www.chromosomewalk.ch

Quiz facile

Quiz expert

BONNE CHANCE !


***********************************************************************************

Pour en savoir plus sur nous...

Pour nous contacter...

Licence et mentions légales

Creative Commons License